1
37
カタログ番号 | 製品名 | 別名 | ターゲット |
---|---|---|---|
TP1154 | Exendin-4 peptide derivative acetate | GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS,Exendin-4 peptide derivative | |
Exendin-4 peptide derivative acetate is an acetate salt of Exendin-4 peptide derivative. |
カタログ番号 | 製品名 | Species | Expression System |
---|---|---|---|
TMPJ-00864 | VEGF165 Protein, Human, Recombinant | Human | HEK293 Cells |
Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator... | |||
TMPY-04911 | VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated | Human,Cynomolgus | HEK293 Cells |
VEGF165 Protein, Human, Recombinant (His & Avi), Biotinylated is expressed in HEK293 mammalian cells with His and Avi tag. The predicted molecular weight is 23.1 kDa and the accession number is P15692-4. | |||
TMPY-00749 | FGF-2 Protein, Human, Recombinant | Human | E. coli |
FGF-2 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 16.5 kDa and the accession number is P09038-4. | |||
TMPK-00823 | VEGF165 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a... | |||
TMPY-04754 | CASK Protein, Human, Recombinant | Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant is expressed in Baculovirus insect cells. The predicted molecular weight is 102.1 kDa and the accession number is O14936-4. | |||
TMPY-01822 | PTK9 Protein, Human, Recombinant (His & GST) | Human | E. coli |
PTK9 Protein, Human, Recombinant (His & GST) is expressed in E. coli expression system with His and GST tag. The predicted molecular weight is 57 kDa and the accession number is Q12792-4. | |||
TMPY-02893 | NT5C3A/NT5C3 Protein, Human, Recombinant | Human | E. coli |
NT5C3A (5'-Nucleotidase, Cytosolic IIIA) is a Protein Coding gene. This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded prot... | |||
TMPY-04471 | APEG1 Protein, Human, Recombinant (His) | Human | E. coli |
Striated muscle preferentially expressed protein kinase, also known as aortic preferentially expressed protein 1, APEG-1, SPEG and KIAA1297, is a protein that belongs to the protein kinase superfamily and CAMK Ser/Thr pr... | |||
TMPK-00822 | VEGF165 Protein, Human, Recombinant (His & Avi), FITC-Labeled | Human | HEK293 Cells |
Vascular endothelial growth factor (VEGF or VEGF-A), also known as vascular permeability factor (VPF), is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. VEGF165 appears to be the most a... | |||
TMPK-00423 | CD45 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com... | |||
TMPY-00380 | ANTXR2 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
ANTXR2 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 57.4 kDa and the accession number is P58335-4. | |||
TMPY-05598 | Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated | Human | HEK293 Cells |
Siglec-2/CD22 Protein, Human, Recombinant (hFc & Avi), Biotinylated is expressed in HEK293 mammalian cells with hFc and Avi tag. The predicted molecular weight is 103.7 kDa and the accession number is P20273-4. | |||
TMPY-01033 | IL-32 Protein, Human, Recombinant (isoform alpha, His) | Human | HEK293 Cells |
IL-32 is a recently discovered cytokine that induces various proinflammatory cytokines (TNF-alpha, IL-1beta, IL-6) and chemokines in both human and mouse cells through the NF-kappaB and p38 MAPK inflammatory signal pathw... | |||
TMPY-01117 | MRAP Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
MRAP (Melanocortin 2 Receptor Accessory Protein) is a Protein Coding gene. This gene encodes a melanocortin receptor-interacting protein. It belongs to the MRAP family. MRAP, which contains a single transmembrane domain,... | |||
TMPK-00424 | CD45 Protein, Human, Recombinant (His & Avi), Biotinylated | Human | HEK293 Cells |
PTPRC (also known as CD45),T cells require the protein tyrosine phosphatase CD45 to detect and respond to antigen because it activates the Src family kinase Lck, which phosphorylates the T cell antigen receptor (TCR) com... | |||
TMPJ-00410 | CD45R0 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
CD45R0 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with C-6xHis tag. The predicted molecular weight is 80-120 KDa and the accession number is P08575-4. | |||
TMPJ-00782 | Amyloid Precursor Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
Amyloid precursor protein (APP) is a type I membrane protein with several isoforms due to alternative splicing, performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and... | |||
TMPJ-00233 | CD200R1/CRTR2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Cell surface glycoprotein CD200 Receptor 1 (CD200R1) is the receptor for the CD200 (OX-2) membrane glycoprotein. CD200R1 contains one C2- type Ig-like domain and one V-type Ig-like domain within its extracellular domain ... | |||
TMPY-01933 | CHI3L2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Chondrocyte protein 39 (YKL-39), also known as Chitinase 3-like 2 (CHI3L2), is a secretory protein of articular chondrocytes belonging to the glycosyl hydrolase 18 family. Its highest expression is in chondrocytes, follo... | |||
TMPY-00119 | FLT1 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
FLT1 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 61.1 kDa and the accession number is P17948-4. | |||
TMPY-00711 | CD45 Protein, Human, Recombinant (hFc) | Human | HEK293 Cells |
CD45 Protein, Human, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 71.1 kDa and the accession number is P08575-4. | |||
TMPY-04565 | SRPK3 Protein, Human, Recombinant (His & GST) | Human | Baculovirus Insect Cells |
Serine / threonine-protein kinase SRPK3, also known as Muscle-specific serine kinase 1, Serine/arginine-rich protein-specific kinase 3, SR-protein-specific kinase 3, Serine / threonine-protein kinase 23, MSSK-1, SRPK3 an... | |||
TMPY-04563 | CASK Protein, Human, Recombinant (His & GST) | Human | Baculovirus Insect Cells |
CASK Protein, Human, Recombinant (His & GST) is expressed in Baculovirus insect cells with His and GST tag. The predicted molecular weight is 130 kDa and the accession number is O14936-4. | |||
TMPY-00225 | CLEC9A Protein, Mouse, Recombinant (hFc) | Mouse | HEK293 Cells |
CLEC9A Protein, Mouse, Recombinant (hFc) is expressed in HEK293 mammalian cells with hFc tag. The predicted molecular weight is 52.1 kDa and the accession number is Q8BRU4-4. | |||
TMPY-01823 | PTK9 Protein, Human, Recombinant | Human | E. coli |
PTK9 Protein, Human, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 29 kDa and the accession number is Q12792-4. | |||
TMPJ-01256 | Caspase-10 Protein, Human, Recombinant (His) | Human | E. coli |
Caspase-10 (CASP10) is a 521 amino acid protein member of the Cysteine-Aspartic Acid Protease (Caspase) family. CASP10 contains two DED (Death Effector) domains and is detectable in most tissues. CASP10 cleavage by Granz... | |||
TMPJ-01333 | TEM8/ANTXR1 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothel... | |||
TMPJ-01188 | CORO6 Protein, Human, Recombinant (His) | Human | E. coli |
Coronin 6, a newly identified member of the coronin family, is highly enriched at adult NMJs and regulates AChR clustering via modulating the interaction between receptors and the actin cytoskeletal network. Coronins are... | |||
TMPK-00702 | ANTXR2 Protein, Human, Recombinant (His) | Human | HEK293 Cells |
The Capillary Morphogenesis Gene 2 (CMG2) gene encodes an Anthrax toxin receptor (ANTXR2),ANTXR2/CMG2 was originally identified as a result of up-regulation during capillary morphogenesis of endothelial cells (ECs) cultu... | |||
TMPK-01356 | SIRP alpha V4 Protein, Human, Recombinant (His & Avi) | Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl... | |||
TMPK-01362 | SIRP alpha V4 Protein, Human, Recombinant (His & Avi), Biotinylated | Human | HEK293 Cells |
Signal regulatory protein α (SIRPα) is a regulatory membrane glycoprotein from SIRP family expressed mainly by myeloid cells and also by stem cells or neurons.SIRPα acts as inhibitory receptor and interacts with a broadl... | |||
TMPK-01505 | HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi), Biotinylated | Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD... | |||
TMPK-01491 | HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi), Biotinylated | Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i... | |||
TMPK-01501 | HLA-A*02:01&B2M&HBV (FLLTRILTI) Tetramer Protein, Human, MHC (His & Avi) | Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i... | |||
TMPK-01492 | HLA-A*02:01&B2M&HBV (FLLTRILTI) Monomer Protein, Human, MHC (His & Avi) | Human | HEK293 Cells |
Hepatitis B virus (HBV), is the leading cause of liver diseases infecting an estimated 240 million persons worldwide. The HBV prevalence rates are variables between different countries, with an high level of endemicity i... | |||
TMPK-01504 | HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Tetramer Protein, Human, MHC (His & Avi) | Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD... | |||
TMPK-01506 | HLA-A*02:01&B2M&HPV16 E7 (YMLDLQPET) Monomer Protein, Human, MHC (His & Avi) | Human | HEK293 Cells |
HPV16 E7 protein, one of the primary target proteins in molecular targeted therapy for HPV-induced cervical cancer. The affitoxin, ZHPV16E7 affitoxin384 was generated by fusing the modified Pseudomonas Exotoxin A (PE38KD... |